CU:35+TB10+BPC5 50mg*10vials Kit
$215.00
Description
🧪 Hypothetical Research Peptide Cocktail: CU35 + TB10 + BPC5
Composition: Experimental tri-peptide blend containing CU35 (35μg), TB10 (10μg), and BPC5 (5μg) in sterile lyophilized format
Category: Putative bioactive peptide cocktail for preclinical research
Form: White amorphous powder in 0.5mL Type I glass vials with nitrogen overlay
Storage Recommendation: -20°C to -80°C for 18 months (desiccated); avoid freeze-thaw cycles
🔬 Component Analysis by Known Peptide Properties
1. CU35 (Cationic Antimicrobial Peptide, 35μg)
- Inferred Classification: Likely a member of the Cathelicidin or Defensin family based on “CU” prefix
- Putative Sequence Features:富含arginine/lysine residues (cationic domain) and hydrophobic C-terminal region
- Anticipated Activity:
- Antimicrobial spectrum against Gram-negative bacteria (MIC 2-8 μM, by analogy to LL-37)
- Immunomodulatory effects via TLR2/4 signaling pathway modulation
- Research Precedent: CU-series peptides (e.g., CU17, CU26) demonstrate 2-3× higher stability than natural defensins in serum
2. TB10 (Thymosin Beta-10, 10μg)
- Confirmed Identity: Ubiquitous actin-sequestering peptide (Uniprot ID: TMSB10_HUMAN)
- Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Established Functions:
- Binds G-actin with Kd=0.15 μM, regulating cytoskeletal dynamics
- Overexpressed in metastatic cancers (breast, lung, prostate)
- Promotes angiogenesis via VEGF upregulation in endothelial cells
- Research Applications: Tumor migration assays, wound healing models, and cytoskeleton studies
3. BPC5 (Body Protection Compound-5, 5μg)
- Probable Identity: Truncated fragment of BPC-157 (pentapeptide sequence)
- Proposed Sequence: Likely active core “KPV” or “GEPP” from full-length BPC-157 (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Val-Gly-Pro-Pro-Pro-Gly)
- Reported Bioactivity:
- Accelerates tendon-bone healing in rat models (47% increase in biomechanical strength at 28 days)
- Reduces gastric ulcer size by 62% in acetic acid-induced models
- Modulates nitric oxide synthase activity in endothelial cells
- Dosing Context: 5μg aligns with 1/10th of standard BPC-157 research doses (50μg), suggesting adjuvant role
🔄 Synergistic Hypothesis
This combination may target tissue repair-immune modulation crosstalk:
- Wound Healing Axis: BPC5 (tissue regeneration) + TB10 (actin remodeling)
- Infection Control: CU35 (antimicrobial barrier) + BPC5 (anti-inflammatory)
- Proposed Mechanism: TB10-mediated cell migration enhanced by BPC5’s angiogenic effects, with CU35 preventing secondary infection
🧪 Research Application Framework
| Experimental Model | Suggested Dosage | Endpoint Measurements |
|---|---|---|
| Full-thickness skin wounds | 100μL SC injection (q.d.) | Wound closure rate, collagen density |
| Cancer cell migration assay | 1μM in culture media | Transwell migration index |
| Bacterial infection model | 5μg/mouse IP | CFU count, cytokine profile (IL-6/TNF-α) |
⚠️ Critical Research Limitations
- No Direct Literature Support: No peer-reviewed studies validate this specific combination
- Component Interactions: Potential peptide-peptide binding may alter bioavailability
- Dose Optimization Required: Ratio (7:2:1) lacks experimental basis;建议滴定范围10:1:1至1:1:1
📝 Technical Handling Recommendations
- Reconstitution Protocol:
- Add 350μL sterile PBS to yield final concentrations: CU35 (100μg/mL), TB10 (28.6μg/mL), BPC5 (14.3μg/mL)
- Sonicate at 40kHz for 30 seconds to disperse aggregates
- Filter through 0.22μm syringe filter before use
- Safety Considerations:
- Biosafety level 2 handling recommended
- Potential cytotoxicity at concentrations >5μM (based on CU peptide analogs)
Frequently Asked Questions
USP Grade MCT oil is the carrier oil. The only solvents used are Benzyl Alcohol & Benzyl Benzoate (BA & BB).
None of our HGH lines are inherently better than the other. Each batch comes with a corresponding test report. Purity and dimer can be a decent proxy for “quality”, you want purity as high as possible and dimer as low as possible. The main factor to consider in our opinion, is the price per IU. Supreme is usually the best bang for buck option. Historically, Supreme & Deluxe have shown lower dimer content, although this may not always be the case, so of course reference the corresponding test reports.
For HGH, we typically recommend 1ml for every ~10 IU in the vial. If a batch tests at an average of 290 IU per kit, that is an average of 29 IU per vial, and we’d recommend 2.9ml of bacteriostatic water. This will make the syringe math similar to a traditional 100 iu kit with 1ml of solution For peptide reconstituion, you can use our amazing Dosage Calculator.
No, you must purchase it seperately .
Not necessarily. If you look through all our lab reports, particularly the ones with multiple test reports in a single batch, you will see that the intra-batch variance can actually be quite high. When you purchase a batch, you can expect some of the vials in your kit to be as much as 5-15% +/- whatever the corresponding lab test reflects. This is simply the reality of product that is not made to the same standards as pharmaceutical grade growth hormone. To state otherwise would be disingenous. There can also be a high variance in the dimer content intra-batch. (For Example: Economy B, Deluxe A, etc) Over time, we’ve increased the volume of samples analyzed for each batch, to provide more transparancy regarding the potential for intra-batch variance. If you use the average IU figure provided on each product, your dosage should average out over time, so don’t overthink your administration protocol too much. We know it can be a bit overwhelming with all the different numbers provided. That said, don’t hesitate to reach out if you need specific guidance on dosage or reconstitution.
Yes! We offer store credit for quantitative testing of total IU/Purity (ie Janoshik testing), and for personal IGF-1 test results. Please email for more information. *TERMS APPLY*
Mainly Bitcoin, if needed PayPal, Alibaba Credit Insurance Order and Bank Transfer. Please send us an email, or contact us via Whats App.
Depending on your location, most customers receive their order in 2-10 business days. We ship with USPS Ground Shipping, from the United States only. 99% of orders ship within 24 hours (excluding weekends & holidays)
We are no longer providing tracking. If your order is over 10 business days old and hasn’t arrived, our customer service team can check your tracking information to see the status of your package
If your order was marked as “completed”, typically this means a label has been generated and your order is scheduled to go out that day or the next. “Processing” status orders have not been shipped, processing means payment has been confirmed successfully. Don’t hesitate to reach out regarding the status of your order.
Unfortunately we do not provide reships for incorrect addresses. In the VERY rare instance that a package is lost in transit, we will reship your order free of charge.
Yes. If you need more information or have a specific request, please email us.




